PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00751.1.p
Common NameEUGRSUZ_D00751, LOC104441101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 358aa    MW: 40037.6 Da    PI: 6.3022
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00751.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
  Eucgr.D00751.1.p 14 KGPWTPEEDQKLVDYIQRHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding52.41.2e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Eucgr.D00751.1.p  67 RGRFSFEEEETIIHLHSILGNK-WSAIASRLP-GRTDNEIKNFWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.783965IPR017930Myb domain
SuperFamilySSF466891.68E-3111108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002499.2E-171461IPR001005SANT/Myb domain
CDDcd001672.59E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007176.0E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.566116IPR017930Myb domain
PfamPF002495.4E-1567111IPR001005SANT/Myb domain
CDDcd001679.81E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLVDYIQ RHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIH LHSILGNKWS AIASRLPGRT DNEIKNFWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILS SSLYNSSQMN FSRLAGVQPQ VNPELLTLAT SLLSSQHQRH  180
SYLPQAPQEI GQSQSQCQAL PENYQMQTPI QEVPACAPAS TQCVSFSDEA SRFLQSNLEQ  240
QFPSNFAVSS SQSSQVIDWK DNGLSSNFTD DYALIPHNYE NLYGLDPAMS NSSAMSTPSS  300
SPAPMNSNST GINGCGTEDE TYSSNMMLTY VVPDILDCNE SQLMGSNQYF GSWSQCQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00751.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052407.10.0PREDICTED: myb-related protein Hv1
TrEMBLA0A059CDX50.0A0A059CDX5_EUCGR; Uncharacterized protein
STRINGVIT_00s0203g00070.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-90MYB-like 102